PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0320969.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 318aa    MW: 36712.2 Da    PI: 7.3316
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0320969.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.51.5e-54101391128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi+evd++k+ePwdL+ k ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+
  Lj0g3v0320969.1  10 VPPGFRFHPTDEELLYYYLRKKVSYEAIDL-DVIREVDLNKLEPWDLKdKcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKA 102
                      69****************************.9***************943444443456*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++++++ +g++ktLvfy+grap+g+ktdW+mheyrl
  Lj0g3v0320969.1 103 IYHSNSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 139
                      ***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-605159IPR003441NAC domain
PROSITE profilePS5100558.61210159IPR003441NAC domain
PfamPF023653.9E-2811139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MMQGSGQLAV PPGFRFHPTD EELLYYYLRK KVSYEAIDLD VIREVDLNKL EPWDLKDKCR  60
IGSGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KAIYHSNSKR IGMRKTLVFY  120
TGRAPHGQKT DWIMHEYRLD DDDAEVQEDG WVVCRVFKKK NTTRGFQQQE IEEEEHFSHM  180
MRPTNNGPCH QILESKHHHH NMQGLYDSSS FDGTIHLPQL FSPESAAVAP TNCMNTMDIL  240
ECSQNLLRLT TTTTGCGLNL MQQQQGDQRF TGDWSFLDKL LASHHPTQPH HAVGSTSAQK  300
FPFHYLGNEA HDIMKFSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-52716414170NO APICAL MERISTEM PROTEIN
1ut4_B4e-52716414170NO APICAL MERISTEM PROTEIN
1ut7_A4e-52716414170NO APICAL MERISTEM PROTEIN
1ut7_B4e-52716414170NO APICAL MERISTEM PROTEIN
4dul_A4e-52716414170NAC domain-containing protein 19
4dul_B4e-52716414170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014500739.10.0PREDICTED: NAC domain-containing protein 76
SwissprotQ9MA171e-120SMB_ARATH; Protein SOMBRERO
TrEMBLA0A0L9UJP90.0A0A0L9UJP9_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SJV80.0A0A0S3SJV8_PHAAN; Uncharacterized protein
STRINGGLYMA08G17140.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72043447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-106NAC family protein